PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RB14Z
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 358aa    MW: 39576.5 Da    PI: 10.1453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RB14ZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-1660104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
      Aradu.RB14Z  60 RERWTDEEHKKFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1754107IPR009057Homeodomain-like
PROSITE profilePS5129421.18755109IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-956107IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-1658107IPR006447Myb domain, plants
SMARTSM007175.3E-1359107IPR001005SANT/Myb domain
PfamPF002495.7E-1460103IPR001005SANT/Myb domain
CDDcd001672.32E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAIHDQNRVT TSQGSPPVGN EVSSGSELHS VTDIQLKDQF STTNDGALKV RKPYTIKKQR  60
ERWTDEEHKK FLEALKLHGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVLR DSSGKIINSA  120
ESIEIPPPRP KRKPMHPYPR KLVGTPNKIT SVKEQPNRSN SLKSQADFDQ ENQSPKSVLT  180
GVGSDSHGSS DSDTPNGSLS PMSSVSGVNS SGFTLVEPKT PSEEAGLNAD SAHNENPLVI  240
SKKEIKASMV EESFGQTVKL FGMTLSVTNT CRPSPSSIEA CKPIPVHINV HCFGKGEGKS  300
ELPSHIVPSE TRATSKLRPR MRTETCGRGF VPYKRFMAER EKNHSSTDRE EQGFRLSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956697.10.0PREDICTED: protein REVEILLE 2-like
TrEMBLA0A0B2PHH51e-145A0A0B2PHH5_GLYSO; Myb-like protein G
STRINGGLYMA18G05050.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.15e-40MYB_related family protein